ATL1 Polyclonal antibody

• 

  WB analysis using 31924-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31924-1-AP (ATL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

ATL1 Polyclonal Antibody for WB, ELISA

Cat No. 31924-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat, pig

Applications

WB, ELISA

Synonyms

Brain-specific GTP-binding protein, Atlastin-1, atlastin1, atlastin GTPase 1, Atlastin 1

---

Tested Applications

• Positive WB detected in: rat brain tissue, fetal human brain tissue, pig brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31924-1-AP targets ATL1 in WB, ELISA applications and shows reactivity with human, rat, pig samples.

• Tested Reactivity: human, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29223

  Product name: Recombinant human ATL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 449-558 aa of BC010708

  Sequence: ATLFVVIFITYVIAGVTGFIGLDIIASLCNMIMGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWDQGSTNEALYKLYSAAATHRHLYHQAFPTPKSESTEQSEKKKM

• Full Name: atlastin GTPase 1
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC010708
• Gene Symbol: ATL1
• Gene ID (NCBI): 51062
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8WXF7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATL1 encodes atlastin-1, a GTPase that plays a crucial role in maintaining the structure and function of the endoplasmic reticulum. Mutations in ATL1 are one of the most common causes of hereditary spastic paraplegia (HSP) (PMID: 38851544). tlastin-1 is regulated by ubiquitination, a post-translational modification that can affect its activity and localization. For example, the E3 ubiquitin ligase SYVN1 has been shown to ubiquitinate atlastin-1, inhibiting its GTPase activity and thereby affecting ER morphology (PMID: 32916628).