ATM Recombinant monoclonal antibody, PBS Only (Detector)

ATM Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 83608-4-PBS
Clone No.240560H8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

240560H8, A T mutated, A-T mutated, EC:2.7.11.1, Serine-protein kinase ATM

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83608-4-PBS targets ATM as part of a matched antibody pair:

MP00592-4: 83608-6-PBS capture and 83608-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25920

Product name: Recombinant human ATM protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1059-1361 aa of BC137169

Sequence: SSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDELALRALKEDRKRFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPTYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANRDEFLTKPEVARRSRITKNVPKQSSQLDEDRTEAANRIICTIRSRRPQMVRSVEALCDAYIILANLDATQWKTQRKGINIPADQPITKLKNLEDVVVPTMEIKVDHTGEYGNLVTIQSFKAEFRLAGGVNLPKIIDCVGSDG

Predict reactive species
Full Name ataxia telangiectasia mutated
GenBank Accession NumberBC137169
Gene Symbol ATM
Gene ID (NCBI) 472
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13315
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The ATM protein is a member of the phosphatidylinositol 3-kinase family of proteins that respond to DNA damage by phosphorylating key substrates involved in DNA repair and/or cell cycle control. It is involved in mitogenic signal transduction, meiotic recombination, detection of DNA damage, and cell cycle control.

Loading...
||
New chat

Able

正在加载,请稍候...