ATM Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP00592-4

  Sandwich ELISA standard curve of MP00592-4, Human ATM Recombinant Matched Antibody Pair - PBS only. 83608-6-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag25920. 83608-4-PBS was HRP conjugated as the detection antibody. Range: 39.1-2500 pg/mL.

• 

  Sample test of MP00592-4

  The mean ATM concentration was determined to be 3,383.80 pg/mL in MCF-7 cell extract based on a 1.20 mg/mL extract load and 3,536.69 pg/mL in MDA-MB-468 cell extract based on a 3.20 mg/mL extract load.

ATM Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83608-6-PBS

Clone No.240560F4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

Serine-protein kinase ATM, EC:2.7.11.1, A-T mutated, A T mutated, 240560F4

---

Product Information

83608-6-PBS targets ATM as part of a matched antibody pair:

MP00592-4: 83608-6-PBS capture and 83608-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25920

  Product name: Recombinant human ATM protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1059-1361 aa of BC137169

  Sequence: SSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDELALRALKEDRKRFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPTYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANRDEFLTKPEVARRSRITKNVPKQSSQLDEDRTEAANRIICTIRSRRPQMVRSVEALCDAYIILANLDATQWKTQRKGINIPADQPITKLKNLEDVVVPTMEIKVDHTGEYGNLVTIQSFKAEFRLAGGVNLPKIIDCVGSDG

• Full Name: ataxia telangiectasia mutated
• GenBank Accession Number: BC137169
• Gene Symbol: ATM
• Gene ID (NCBI): 472
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13315
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.