ATP11B Polyclonal antibody

• 

  IHC staining of human ovary tumor using 13672-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 13672-1-AP (ATP11B Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human ovary tumor using 13672-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 13672-1-AP (ATP11B Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human ovary tumor using 13672-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 13672-1-AP (ATP11B antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human ovary tumor using 13672-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 13672-1-AP (ATP11B antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of HEK-293 using 13672-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using ATP11B antibody (13672-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

ATP11B Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 13672-1-AP

Publications(3)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Phospholipid-transporting ATPase IF, P4-ATPase flippase complex alpha subunit ATP11B, EC:7.6.2.1, ATPIR, ATPIF

---

Tested Applications

• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

13672-1-AP targets ATP11B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4654

  Product name: Recombinant human ATP11B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 10-104 aa of BC033880

  Sequence: SSGSAWFAIILMVVTCLFLDIIKKVFDRHLHPTSTEKAQLTETNAGIKCLDSMCCFPEGEAACASVGRMLERVIGRCSPTHISRCEISLSSLCCR

• Full Name: ATPase, class VI, type 11B
• Calculated Molecular Weight: 1177aa, 134 kDa
• GenBank Accession Number: BC033880
• Gene Symbol: ATP11B
• Gene ID (NCBI): 23200
• RRID: AB_2063150
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2G3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	IF	Acta Neuropathol; Loss of the heterogeneous expression of flippase ATP11B leads to cerebral small vessel disease in a normotensive rat model.; Authors - Sophie Quick
human,mouse	WB,IHC	J Immunother Cancer; Oncolytic peptide LTX-315 induces anti-pancreatic cancer immunity by targeting the ATP11B-PD-L1 axis.; Authors - Tianyu Tang ; KO Validated
rat	WB	Life Sci; miRNA-150-5p associate with antihypertensive effect of epigallocatechin-3-gallate revealed by aorta miRNome analysis of spontaneously hypertensive rat.; Authors - Bing-Jun Qian

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Ruby (Verified Customer) (06-01-2025)

I never got any selective staining.

• Applications: Western Blot, Immunofluorescence
• Primary Antibody Dilution: 1 in 1000 (WB), 1 in 400 (IF)
• Cell Tissue Type: Platelets