ATP1B1 Recombinant monoclonal antibody, PBS Only

ATP1B1 Uni-rAb® Recombinant Antibody for WB, IHC, Indirect ELISA
Cat No. 84707-5-PBS
Clone No.242109D12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

242109D12, ATP1B 1, Beta 1 subunit of Na(+) K(+) ATPase, Na, K-ATPase β1, Na+/K+ ATPase beta 1 subunit

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84707-5-PBS targets ATP1B1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7279

Product name: Recombinant human ATP1B1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 59-303 aa of BC000006

Sequence: LTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS

Predict reactive species
Full Name ATPase, Na+/K+ transporting, beta 1 polypeptide
Calculated Molecular Weight 35 kDa
Observed Molecular Weight 45-52 kDa
GenBank Accession NumberBC000006
Gene Symbol ATP1B1
Gene ID (NCBI) 481
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP05026
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ATP1B1 is one of beta subunits of the Na+/K+ ATPase and responsible for formation and structural integrity of the Na+/K+ ATPase. The Na+/K+ ATPase is a plasma membrane pump consisting of alpha, beta, and gamma subunits. At least four of Na+/K+-ATPase beta subunits (β1, β2, β3, β4) have been identified in mammalian cells; the β1-subunit (ATP1B1) is the most ubiquitous. The Na+/K+ ATPase β subunits have multiple N-glycosylation sites. The predicted MW of ATP1B1 is 35 kDa, while it migrates around 40-52 kDa due to the variable glycosylation. (PMID: 10896885, 17714085)

Loading...
||
New chat Able
正在加载,请稍候...