ATP1B2 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ATP1B2 Recombinant monoclonal antibody (88109-1-RR)

ATP1B2 Uni-rAb^® Recombinant Antibody for WB, IF-P, ELISA

Cat No. 88109-1-RR

Clone No.260382A9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, ELISA

Synonyms

Adhesion molecule in glia, ATPase Na+/K+ beta 2, Sodium/potassium-dependent ATPase subunit beta-2, Sodium/potassium-transporting ATPase subunit beta-2

• 

  WB analysis using 88109-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 88109-1-RR (ATP1B2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 88109-1-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using ATP1B2 antibody (88109-1-RR, Clone: 260382A9 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue, fetal human brain tissue
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

88109-1-RR targets ATP1B2 in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg6094

  Product name: Recombinant human AT1B2 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 68-290 aa of NM_001678.4

  Sequence: DHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT

• Full Name: ATPase, Na+/K+ transporting, beta 2 polypeptide
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 45-65 kDa
• GenBank Accession Number: NM_001678.4
• Gene Symbol: ATP1B2
• Gene ID (NCBI): 482
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P14415
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATP1B2 is the β2 subunit of Na+/K+-ATPase which is an essential membrane-bound enzyme responsible for the transport of Na+ and K+ in most eukaryotic cells. ATP1B2 is also called the adhesion molecule on glia (AMOG) and it is highly expressed in normal glia. It is a heavily glycosylated protein that plays a role in cellular adhesion in the CNS. Recently differential expression of ATP1B2 has been found in some glioneuronal tumors (PMID: 23887941, 19371356). This antibody recognizes the endogenous ATP1B2 protein in human brain. The bands between 45 kDa and 65 kDa represent the glycosylated forms of ATP1B2 in different levels (PMID: 8918259).