ATP1B3 Polyclonal antibody

• 

  WB analysis using 11142-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11142-1-AP (ATP1B3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human prostate cancer using 11142-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11142-1-AP (ATP1B3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 11142-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11142-1-AP (ATP1B3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 11142-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11142-1-AP (ATP1B3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 11142-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11142-1-AP (ATP1B3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 11142-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using ATP1B3 antibody (11142-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

ATP1B3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11142-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ATPB 3, ATPB-3, CD298, Sodium/potassium-dependent ATPase subunit beta-3, Sodium/potassium-transporting ATPase subunit beta-3

---

Tested Applications

• Positive WB detected in: Jurkat cells, THP-1 cells
• Positive IHC detected in: human prostate cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

11142-1-AP targets ATP1B3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1589

  Product name: Recombinant human ATP1B3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-279 aa of BC011835

  Sequence: MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA

• Full Name: ATPase, Na+/K+ transporting, beta 3 polypeptide
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 32-43 kDa
• GenBank Accession Number: BC011835
• Gene Symbol: ATP1B3
• Gene ID (NCBI): 483
• RRID: AB_2274459
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P54709
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATP1B3 (also known as CD298) is the β3 subunit of Na+/K+-ATPase which functions to maintain sodium and potassium gradients across membranes involved in cellular activities. ATP1B3 is a glycosylated protein and there are fully and intermediately glycosylated forms of ATP1B3 in mammalian cells. The predicted MW of ATP1B3 is around 32 kDa, while various forms (38-43 kDa) can be observed due to the different level of glycosylation (PMID: 30792309, 16339171, 17176442).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Rep; ATP6V0D1 promotes alkaliptosis by blocking STAT3-mediated lysosomal pH homeostasis; Authors - Fangquan Chen
human	WB	Front Oncol; ATP1B3 may promote glioma proliferation and migration through MAPK/NF-KB signaling pathway; Authors - Qikang Yan