ATP2A1 Recombinant monoclonal antibody, PBS Only

ATP2A1 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 84213-5-PBS
Clone No.241500D12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

241500D12, ATP2A, ATP2A 1, Calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletal muscle isoform, EC:7.2.2.10

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84213-5-PBS targets ATP2A1 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag17944

Product name: Recombinant human ATP2A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 561-635 aa of BC037354

Sequence: RCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVG

Predict reactive species
Full Name ATPase, Ca++ transporting, cardiac muscle, fast twitch 1
Calculated Molecular Weight 1001 aa, 110 kDa
Observed Molecular Weight 110 kDa
GenBank Accession NumberBC037354
Gene Symbol ATP2A1
Gene ID (NCBI) 487
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDO14983
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ATP2A1 also known as SERCA1, encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen and is involved in muscular excitation and contraction. Mutations in ATP2A1 cause some autosomal recessive forms of Brody disease(PMID: 23911890, 10914677).

Loading...
||
New chat Able
正在加载,请稍候...