ATP4B Polyclonal antibody

• 

ATP4B Polyclonal Antibody for ELISA

Cat No. 12960-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

ATP4B, ATP6B, Proton pump beta chain

---

Product Information

12960-1-AP targets ATP4B in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4071

  Product name: Recombinant human ATP4B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 64-291 aa of BC029059

  Sequence: QTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK

• Full Name: ATPase, H+/K+ exchanging, beta polypeptide
• Calculated Molecular Weight: 33 kDa
• GenBank Accession Number: BC029059
• Gene Symbol: ATP4B
• Gene ID (NCBI): 496
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51164
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.