ATP5I Recombinant monoclonal antibody, PBS Only (Capture)

ATP5I Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA, Sample test
Cat No. 86218-2-PBS
Clone No.250815C6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA, Sample test

ATP synthase membrane subunit e, ATP synthase subunit e, mitochondrial, N-terminally processed, ATP5K, ATP5ME, ATPase subunit e

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86218-2-PBS targets ATP5I as part of a matched antibody pair:

MP02299-1: 86218-2-PBS capture and 86218-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9605

Product name: Recombinant human ATP5I protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-69 aa of BC003679

Sequence: MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK

Predict reactive species
Full Name ATP synthase, H+ transporting, mitochondrial F0 complex, subunit E
Calculated Molecular Weight 69 aa, 8 kDa
Observed Molecular Weight 8 kDa
GenBank Accession NumberBC003679
Gene Symbol ATP5I
Gene ID (NCBI) 521
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP56385
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ATP5I(ATP synthase subunit e) is also named as ATP5K and belongs to the ATPase e subunit family. The ATP5I gene encodes the e subunit of the mitochondrial ATP synthase Fo complex. Mitochondrial membrane ATP synthase(F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. Antisense ATP5I in a human HCC cell line inhibited cell growth suggesting that ATP5I acts through the MAP kinase pathway(PMID:11939412).

Loading...
||
New chat Able
正在加载,请稍候...