ATP5SL Polyclonal antibody

• 

  WB analysis using 23866-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23866-1-AP (ATP5SL antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

ATP5SL Polyclonal Antibody for WB, ELISA

Cat No. 23866-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ATP5S like, ATP5SL, Distal membrane-arm assembly complex protein 2, DMAC2

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23866-1-AP targets ATP5SL in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20909

  Product name: Recombinant human ATP5SL protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-158 aa of BC013323

  Sequence: MAAPWASLRLVAPMWNGRIRGIHRLGAAVAPEGNQKKKRTILQFLTNYFYDVEALRDYLLQREMYKVHEKNRFRDKEWIRPDKYGHFSQEFWNFCEVPVEAVDAGDCDINYEGLDNLRTSAGWTSRTSLPCPTLASLRYWWRRCCPIARLWESTGLRA

• Full Name: ATP5S-like
• Calculated Molecular Weight: 158 aa, 19 kDa
• Observed Molecular Weight: 29-32 kDa
• GenBank Accession Number: BC013323
• Gene Symbol: ATP5SL
• Gene ID (NCBI): 55101
• RRID: AB_3669421
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9NW81
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.