ATP6V1C2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ATP6V1C2 Polyclonal antibody (16274-1-AP)

• Featured Product
• KD/KO Validated

ATP6V1C2 Polyclonal Antibody for WB, ELISA

Cat No. 16274-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

ATP6C2, V-ATPase subunit C 2, VMA5, V-type proton ATPase subunit C 2

• 

  WB analysis of mouse kidney using 16274-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 16274-1-AP (ATP6V1C2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human kidney using 16274-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 16274-1-AP (ATP6V1C2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 16274-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 16274-1-AP (ATP6V1C2 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 16274-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 16274-1-AP (ATP6V1C2 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 16274-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 16274-1-AP (ATP6V1C2 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 16274-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16274-1-AP (ATP6V1C2 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 16274-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 16274-1-AP (ATP6V1C2 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ATP6V1C2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, human kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16274-1-AP targets ATP6V1C2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9349

  Product name: Recombinant human ATP6V1C2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-381 aa of BC012142

  Sequence: MSEFWLISAPGDKENLQALERMNTVTSKSNLSYNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAESLIRRMAQSVVEVMEDSKGKVQEHLLANGVDLTSFVTHFEWDMAKYPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYDTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEYLVTLLVIVPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYDEKEIEREREEMARLLSDKKQQYGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSSTKRLREVLNSVFRHLDEVAATSILDASVEIPGLQLNNQDYFPYVYFHIDLSLLD

• Full Name: ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2
• Calculated Molecular Weight: 381 aa, 44 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC012142
• Gene Symbol: ATP6V1C2
• Gene ID (NCBI): 245973
• RRID: AB_2062522
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NEY4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ATP6V1C2 polyclonal antibody (Cat# 16274-1-AP) has 4 total citations. These appear in Nature Communications, Environmental Health Perspectives, Pathology Research and Practice, and Frontiers in Genetics. The research fields span lysosomal dysfunction and ferroptosis, inorganic arsenic effects on prostate stem-progenitor cell transformation and NRF2 pathway activation, prognostic value of ATP6V1C2 in colorectal cancer, and survival prediction in colon adenocarcinoma.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Nat Commun; Senescence-associated lysosomal dysfunction impairs cystine deprivation-induced lipid peroxidation and ferroptosis; Authors - Tze Mun Loo
human	WB,IF	Environ Health Perspect; Effects of Inorganic Arsenic on Human Prostate Stem-Progenitor Cell Transformation, Autophagic Flux Blockade, and NRF2 Pathway Activation.; Authors - Lishi Xie ; KD Validated
human	WB	Pathol Res Pract; Comprehensive analysis of ATP6V1s family member, ATP6V1C2, with prognostic and drug development values in colorectal cancer; Authors - Jun Li
human	WB,IHC	Front Genet; High Expression of ATP6V1C2 Predicts Unfavorable Overall Survival in Patients With Colon Adenocarcinoma; Authors - Guanghua Li