ATP6V1E1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83636-6-RR (same clone as 83636-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83636-6-RR (ATP6V1E1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83636-6-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 83636-6-RR (same clone as 83636-6-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 83636-6-RR (ATP6V1E1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83636-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83636-6-RR

  Biolayer interferometry (BLl) kinetic assays of 83636-6-RR against Human ATP6V1E1 were performed. The affinity constant is 5.43 nM.

ATP6V1E1 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 83636-6-PBS

Clone No.240584G12

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, ELISA

Synonyms

V-ATPase subunit E 1, V-ATPase 31 kDa subunit, P31, ATP6E2, ATP6E

---

Product Information

83636-6-PBS targets ATP6V1E1 in WB, IHC, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7399

  Product name: Recombinant human ATP6V1E1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-226 aa of BC004443

  Sequence: MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD

• Full Name: ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC004443
• Gene Symbol: ATP6V1E1
• Gene ID (NCBI): 529
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P36543
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATP6V1E1, also named as ATP6E, ATP6E2 and p31, belongs to the V-ATPase E subunit family. It is a subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. V-ATPase and the lack of mycobacterial phagosome acidification are directly attributed to the Mtb protein tyrosine phosphatase PtpA.