ATP6V1F Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87157-1-RR (same clone as 87157-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87157-1-RR (ATP6V1F antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87157-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 87157-1-RR (same clone as 87157-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 87157-1-RR (ATP6V1F antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87157-1-PBS in a different storage buffer formulation.

• 

  Affinity of 87157-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87157-1-RR against Human ATP6V1F were performed. The affinity constant is 0.247 nM.

ATP6V1F Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 87157-1-PBS

Clone No.252263C1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

ATP6S14, V ATPase 14 kDa subunit, V ATPase subunit F, V type proton ATPase subunit F, Vacuolar proton pump subunit F

---

Product Information

87157-1-PBS targets ATP6V1F in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12121

  Product name: Recombinant human ATP6V1F protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-119 aa of BC107854

  Sequence: MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR

• Full Name: ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F
• Calculated Molecular Weight: 119 aa, 13 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC107854
• Gene Symbol: ATP6V1F
• Gene ID (NCBI): 9296
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16864
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATP6V1F(V-type proton ATPase subunit F) is also named as ATP6S14, VATF and belongs to the V-ATPase F subunit family. It generates an electrochemical proton gradient that is acid and positive inside synaptic vesicles. ATP6V1F plays a major role as energizers of animal plasma membranes, especially apical plasma membranes of epithelial cells. This protein has 2 isoforms produced by alternative splicing with the molecular weight of 14 kDa and 16 kDa.