ATPAF2 Monoclonal antibody, PBS Only (Capture)

ATPAF2 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 68351-1-PBS
Clone No.1H9A9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

ATP12, LP3663, ATP12p, ATP12 homolog, 1H9A9

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68351-1-PBS targets ATPAF2 as part of a matched antibody pair:

MP50625-1: 68351-1-PBS capture and 68351-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29065

Product name: Recombinant human ATPAF2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 42-192 aa of BC032126

Sequence: PPTERKRFYQNVSITQGEGGFEINLDHRKLKTPQAKLFTVPSEALAIAVATEWDSQQDTIKYYTMHLTTLCNTSLDNPTQRNKDQLIRAAVKFLDTDTICYRVEEPETLVELQRNEWDPIIEWAEKRYGVEISSSTSIMGPSIPAKTREVL

Predict reactive species
Full Name ATP synthase mitochondrial F1 complex assembly factor 2
Calculated Molecular Weight 289 aa, 33 kDa
Observed Molecular Weight~30 kDa
GenBank Accession NumberBC032126
Gene Symbol ATPAF2
Gene ID (NCBI) 91647
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ8N5M1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ATP synthase mitochondrial F1 complex assembly factor 2 (ATPAF2) also name as ATP12 and ATP12p, is an essential house keeping protein. ATPAF2 is an assembly factor for the F1 component of mitochondrial ATP synthase. This protein binds specifically to the F1 alpha subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. The calculated MW is 33 kDa, 68351-1-Ig can detect bands around 30 kDa and 50 kDa, the larger band may correspond to dimer or complex form. (PMID: 1826907, 11410595)

Loading...
||
New chat Able
正在加载,请稍候...