ATPBD3 Polyclonal antibody

• 

  WB analysis using 31537-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 31537-1-AP (ATPBD3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 31537-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 31537-1-AP (ATPBD3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of PC-3 using 31537-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using ATPBD3 antibody (31537-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

ATPBD3 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 31537-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

NCS6, CTU1

---

Tested Applications

• Positive WB detected in: HeLa cells, K-562 cells
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31537-1-AP targets ATPBD3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35037

  Product name: Recombinant human ATPBD3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 50-200 aa of NM_145232

  Sequence: PGAVVAVGASGGKDSTVLAHVLRALAPRLGISLQLVAVDEGIGGYRDAALAAVRRQAARWELPLTVVAYEDLFGGWTMDAVARSTAGSGRSRSCCTFCGVLRRRALEEGARRVGATHIVTGHNADDMAETVLMNFLRGDAGRLARGGGLGS

• Full Name: ATP binding domain 3
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 30-36 kDa
• GenBank Accession Number: NM_145232
• Gene Symbol: ATPBD3
• Gene ID (NCBI): 90353
• RRID: AB_3670027
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q7Z7A3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATPBD3, also known as CTU1, NCS6, is a subunit of a highly conserved protein complex involved in the thiolation of wobble U34(PMID: 18391219). ATPBD3 directly binds tRNAs and probably acts by catalyzing the adenylation of tRNAs, an intermediate required for 2-thiolation.