ATPBD3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84318-4-RR (same clone as 84318-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84318-4-RR (ATPBD3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84318-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 84318-4-RR (same clone as 84318-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 84318-4-RR (ATPBD3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84318-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 84318-4-RR (same clone as 84318-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 84318-4-RR (ATPBD3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84318-4-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse kidney using 84318-4-RR (same clone as 84318-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse kidney tissue using ATPBD3 antibody (84318-4-RR, Clone: 241630C4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84318-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84318-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84318-4-RR against Human ATPBD3 were performed. The affinity constant is 0.406 nM.

ATPBD3 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 84318-4-PBS

Clone No.241630C4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

241630C4, CTU1, NCS6

---

Product Information

84318-4-PBS targets ATPBD3 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35037

  Product name: Recombinant human ATPBD3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 50-200 aa of NM_145232

  Sequence: PGAVVAVGASGGKDSTVLAHVLRALAPRLGISLQLVAVDEGIGGYRDAALAAVRRQAARWELPLTVVAYEDLFGGWTMDAVARSTAGSGRSRSCCTFCGVLRRRALEEGARRVGATHIVTGHNADDMAETVLMNFLRGDAGRLARGGGLGS

• Full Name: ATP binding domain 3
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: NM_145232
• Gene Symbol: ATPBD3
• Gene ID (NCBI): 90353
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q7Z7A3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATPBD3, also known as CTU1, NCS6, is a subunit of a highly conserved protein complex involved in the thiolation of wobble U34(PMID: 18391219). ATPBD3 directly binds tRNAs and probably acts by catalyzing the adenylation of tRNAs, an intermediate required for 2-thiolation.