ATPBD4 Polyclonal antibody

• 

  WB analysis of NIH/3T3 using 23993-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 23993-1-AP (ATPBD4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of L02 using 23993-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 23993-1-AP (ATPBD4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of NIH/3T3 using 23993-1-AP

  Immunofluorescent analysis of NIH/3T3 cells using 23993-1-AP (ATPBD4 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

ATPBD4 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 23993-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

ATP binding domain 4, ATPBD4, Diphthamide synthase, Diphthamide synthetase, Diphthine-ammonia ligase, DPH6, Protein DPH6 homolog

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells, L02 cells
• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

23993-1-AP targets ATPBD4 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21178

  Product name: Recombinant human ATPBD4 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-259 aa of BC008485

  Sequence: GGKDSCYNMMQCIAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDLYAEAMALPLYRRTIRGRSLDTRQVYTKCEGDEVEDLYELLKLVKEKEEVEGISVGAILSDYQRIRVENVCKRLNLQPLAYLWQRNQEDLLREMISSNIQAMIIKVAALGLDPDKHLGKTLDQMEPYLIELSKKYGVHVCGEGGEYETFTLDCPLFKKKIIVDSSEVVIHSADAFAPVAYLRFLELHLEDKVSSVPDNYRTSNYIYNF

• Full Name: ATP binding domain 4
• Calculated Molecular Weight: 267 aa, 30 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC008485
• Gene Symbol: ATPBD4
• Gene ID (NCBI): 89978
• RRID: AB_2879392
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L8W6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Diphthamide is a highly modified histidine in the transcription factor EEF2 that is conserved from yeast to human. ATPBD4, also known as DPH6, belongs to the Diphthine--ammonia ligase family. DPH6 amidase may catalyze the last step of diphthamide biosynthesis using ammonium and ATP to play a role in catalyzing the final step of diphthamide biosynthesis, amidation of diphthine to diphthamide (PubMed:23169644).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Brain Sci; Differential Expression of Multiple Disease-Related Protein Groups Induced by Valproic Acid in Human SH-SY5Y Neuroblastoma Cells.; Authors - Tsung-Ming Hu