ATRIP Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ATRIP Polyclonal antibody (11327-1-AP)

• Featured Product
• KD/KO Validated

ATRIP Polyclonal Antibody for WB, IP, ELISA

Cat No. 11327-1-AP Copied!

Publications (7)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, CoIP, ELISA

Synonyms

AGS 1, AGS1, ATM and Rad3-related-interacting protein, ATR-interacting protein, DRN 3

• 

  WB analysis using 11327-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11327-1-AP (ATRIP antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 11327-1-AP

  WB result of ATRIP antibody (11327-1-AP; 1:5000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ATRIP transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 11327-1-AP

  IP result of anti-ATRIP (IP:11327-1-AP, 4ug; Detection:11327-1-AP 1:5000) with HeLa cells lysate 1200 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ATRIP in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, PC-3 cells
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11327-1-AP targets ATRIP in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1869

  Product name: Recombinant human ATRIP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 464-765 aa of BC014153

  Sequence: PEDSVCILEGFSVTALSILQHLVCHSGAVVSLLLSGVGADSAAGEGNRSLVHRLSDGDMTSALRGVADDQGQHPLLKMLLHLLAFSSAATGHLQASVLTQCLKVLVKLAENTSCDFLPRFQCVFQVLPKCLSPETPLPSVLLAVELLSLLADHDQLAPQLCSHSEGCLLLLLYMYITSRPDRVALETQWLQLEQEVVRALTVMLHRQWLTVRRAGGPPRTDQQRRTVRCLRDTVLLLHGLSQKDKLFMMHCVEVLHQFDQVMPGVSMLIRGLPDVTDCEEAALDDLCAAETDVEDPEVECG

• Full Name: ATR interacting protein
• Calculated Molecular Weight: 791 aa, 86 kDa
• Observed Molecular Weight: 86-90 kDa
• GenBank Accession Number: BC014153
• Gene Symbol: ATRIP
• Gene ID (NCBI): 84126
• RRID: AB_10837229
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WXE1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATRIP (ATR Interacting Protein) and ATR signalling complex is a central mediator of the replicative stress response (RSR),and mutations in both genes have been reported in Seckel syndrome.

Publications

What published studies show

The ATRIP Polyclonal antibody (Cat# 11327-1-AP) has 7 citations published in journals including Biomaterials, Oncogene, Brain, Behavior, and Immunity, Cell Insight, Frontiers in Pharmacology, and Biochemical Journal. Research fields span DNA damage response and repair, cancer chemoresistance, obesity and metabolic dysfunction, sepsis-associated encephalopathy, renal fibrosis, and CHK1 inhibitor resistance. Applications include WB, IHC, CoIP, and IP in human and mouse models.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IHC	Biomaterials; A fluorinated peptide with high serum- and lipid-tolerence for the delivery of siRNA drugs to treat obesity and metabolic dysfunction.; Authors - Jin Qiu ; KD Validated
human	WB,CoIP	Oncogene; Phospho-TRIM21 orchestrates RPA2 ubiquitination switch to promote homologous recombination and tumor radio/chemo-resistance; Authors - Jie Zhang
mouse	WB,IP,IHC	Brain Behav Immun; Targeting AARS1-dependent lactylation improves neuronal process plasticity and mitigates cognitive deficits in sepsis-associated encephalopathy.; Authors - Shiyuan Luo
human	WB	Cell Insight; ATR/Chk1 interacting lncRNA modulates DNA damage response to induce breast cancer chemoresistance; Authors - Rong Luo
human	WB	Front Pharmacol; Huangkui Capsule Ameliorates Renal Fibrosis in a Unilateral Ureteral Obstruction Mouse Model Through TRPC6 Dependent Signaling Pathways.; Authors - Li-Fei Gu
mouse	WB	Biochem J; Mutation of the RelA(p65) Thr505 phosphosite disrupts the DNA replication stress response leading to CHK1 inhibitor resistance; Authors - Jill E Hunter