ATXN2L Recombinant monoclonal antibody

• 

  WB analysis using 86613-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86613-3-RR (ATXN2L antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of Jurkat using 86613-3-RR

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using ATXN2L antibody (86613-3-RR, Clone: 251578A9 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity and Kinetic Characterization of 86613-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86613-3-RR against Human ATXN2L were performed. The affinity constant is 1.78 nM.

ATXN2L Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86613-3-RR

Clone No.251578A9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

A2D, A2LG, A2LP, A2RP, ataxin 2 like

---

Tested Applications

• Positive WB detected in: HeLa cells, MKN-45 cells, HEK-293T cells, A549 cells, Jurkat cells
• Positive IF/ICC detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86613-3-RR targets ATXN2L in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag20581

  Product name: Recombinant human ATXN2L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 712-1062 aa of BC082760

  Sequence: SYIPQIHMGPAVQAPQMYPYPVSNSVPGQQGKYRGAKGSLPPQRSDQHQPASAPPMMQAAAAAGPPLVAATPYSSYIPYNPQQFPGQPAMMQPMAHYPSQPVFAPMLQSNPRMLTSGSHPQAIVSSSTPQYPSAEQPTPQALYATVHQSYPHHATQLHAHQPQPATTPTGSQPQSQHAAPSPVQHQAGQAPHLGSGQPQQNLYHPGALTGTPPSLPPGPSAQSPQSSFPQPAAVYAIHHQQLPHGFTNMAHVTQAHVQTGITAAPPPHPGAPHPPQVMLLHPPQSHGGPPQGAVPQSGVPALSASTPSPYPYIGHPQGEQPGQAPGFPGGADDRILQSHPSQQLPFHPPGN

• Full Name: ataxin 2-like
• Calculated Molecular Weight: 1062 aa, 112 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC082760
• Gene Symbol: ATXN2L
• Gene ID (NCBI): 11273
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8WWM7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATXN2L is a paralog of Ataxin-2 (ATXN2) but without abnormal polyQ expended track, which is conserved in most of the ATXNs and drives the pathogenesis of neurodegeneration. It was reported that ATXN2L was widely expressed in immortalized cell lines, and ATXN2L-JAK2 fusion was found in CD4-positive T-cell lymphoma.