ATXN3L Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ATXN3L Polyclonal antibody, PBS Only (23166-1-PBS)

• 

  WB analysis of human testis using 23166-1-AP (same clone as 23166-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 23166-1-AP (ATXN3L Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23166-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 23166-1-AP (same clone as 23166-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 23166-1-AP (ATXN3L Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23166-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 23166-1-AP (same clone as 23166-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 23166-1-AP (ATXN3L Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 23166-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 23166-1-AP (same clone as 23166-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 23166-1-AP (ATXN3L Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 23166-1-PBS in a different storage buffer formulation.

ATXN3L Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 23166-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

Ataxin-3-like protein, ATX3L, EC:3.4.19.12, Machado-Joseph disease protein 1-like, MJDL

---

Product Information

23166-1-PBS targets ATXN3L in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19611

  Product name: Recombinant human ATXN3L protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 180-341 aa of BC137187

  Sequence: IISVEEMDTPKLNGKKLVKQKEHRVYKTVLEKVSEESDESGTSDQDEEDFQRALELSRQETNREDEHLRSTIELSMQGSSGNTSQDLPKTSCVTPASEQPKKIKEDYFEKHQQEQKQQQQQSDLPGHSSYLHERPTTSSRAIESDLSDDISEDTVQAAVDTI

• Full Name: ataxin 3-like
• Calculated Molecular Weight: 355 aa, 41 kDa
• Observed Molecular Weight: 41 kDa
• GenBank Accession Number: BC137187
• Gene Symbol: ATXN3L
• Gene ID (NCBI): 92552
• RRID: AB_2879221
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H3M9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATXN3L, also named as Ataxin-3-like protein, is a 355 amino acid protein, which contains 1 Josephin domain and 2 UIM (ubiquitin-interacting motif) domains. ATXN3L localizes in the nucleus and as a deubiquitinating enzyme that cleaves both 'Lys-48'-linked and 'Lys-63'-linked poly-ubiquitin chains.