AURKAIP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• AURKAIP1 Polyclonal antibody (17528-1-AP)

• 

  IF Staining of HepG2 using 17528-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using AURKAIP1 antibody (17528-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

AURKAIP1 Polyclonal Antibody for IF/ICC, ELISA

Cat No. 17528-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, ELISA

Synonyms

28S ribosomal protein S38, mitochondrial, AIP, AKIP, AURKA interacting protein, AURKA-interacting protein

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17528-1-AP targets AURKAIP1 in IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11444

  Product name: Recombinant human AURKAIP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-199 aa of BC062333

  Sequence: MLLGRLTSQLLRAVPWAGGRPPWPVSGVLGSRVCGPLYSTSPAGPGRAASLPRKGAQLELEEMLVPRKMSVSPLESWLTARCFLPRLDTGTAGTVAPPQSYQCPPSQIGEGAEQGDEGVADAPQIQCKNVLKIRRRKMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLRGK

• Full Name: aurora kinase A interacting protein 1
• Calculated Molecular Weight: 199 aa, 22 kDa
• GenBank Accession Number: BC062333
• Gene Symbol: AURKAIP1
• Gene ID (NCBI): 54998
• RRID: AB_3741922
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NWT8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AURKAIP1 (Aurora-A kinase interacting protein 1) has been identified as an Aurora-A kinase interacting protein involving in two degradation pathways of Aurora-A, including proteasome-dependent pathway and Ub-independent pathway . Ectopic expression of AURKAIP1 resulted in the down-regulation of Aurora-A protein levels and thus, AURKAIP1 could be regarded as a cancer suppressor involving Aurora-A pathway.(PMID: 38040691,PMID: 17125467)