AVEN Polyclonal antibody

• 

  WB analysis of MCF-7 using 25846-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 25846-1-AP (AVEN Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 25846-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 25846-1-AP (AVEN Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

AVEN Polyclonal Antibody for WB, ELISA

Cat No. 25846-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

AVEN, Cell death regulator Aven, PDCD12

---

Tested Applications

• Positive WB detected in: MCF-7 cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

25846-1-AP targets AVEN in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23020

  Product name: Recombinant human AVEN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-362 aa of BC010488

  Sequence: MQAERGARGGRGRRPGRGRPGGDRHSERPGAAAAVARGGGGGGGGDGGGRRGRGRGRGFRGARGGRGGGGAPRGSRREPGGWGAGASAPVEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTDFSVLLSSAGDSFSQFRFAEEKEWDSEASCPKQNSAFYVDSELLVRALQELPLCLRLNVAAELVQGTVPLEVPQVKPKRTDDGKGLGMQLKGPLGPGGRGPIFELKSVAAGCPVLLGKDNPSPGPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSKNVTEEELEDWLDSMIS

• Full Name: apoptosis, caspase activation inhibitor
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC010488
• Gene Symbol: AVEN
• Gene ID (NCBI): 57099
• RRID: AB_2880266
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQS1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AVEN (Apoptosis caspase activation inhibitor) is known to play a role in male and female germ cell development. AVEN protein has also been shown to inhibit the mitochondrial apoptosis pathway by binding to and inhibiting the self-association of proapoptotic APAF-1, as well as binding to and enhancing antiapoptotic BCL-xL activity. AVEN has also recently been shown to function as an activator of the cell cycle-regulating ATM kinase in the DNA damage response pathway. Molecular weight of this protein detected by WB is 50 kDa (PMID: 22751129).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Open Med (Wars); Tanshinone IIA reverses oxaliplatin resistance in colorectal cancer through microRNA-30b-5p/AVEN axis.; Authors - Tingrui Ge
human	WB	Front Oncol; Integrative proteomics and m6A microarray analyses of the signatures induced by METTL3 reveals prognostically significant in gastric cancer by affecting cellular metabolism; Authors - Guisen Peng