AVPR2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• AVPR2 Polyclonal antibody (27691-1-AP)

• 

  WB analysis using 27691-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27691-1-AP (AVPR2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27691-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27691-1-AP (AVPR2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

AVPR2 Polyclonal Antibody for WB, ELISA

Cat No. 27691-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ADHR, Antidiuretic hormone receptor, AVPR V2, DI1, DIR

---

Tested Applications

• Positive WB detected in: 769-P cells, 786-O cells, Caki-1 cells, Caki-2 cells, OS-RC-2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27691-1-AP targets AVPR2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24835

  Product name: Recombinant human AVPR2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-83 aa of BC112181

  Sequence: MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLAALARRGRRGHWAPIHVFIGHLCL

• Full Name: arginine vasopressin receptor 2
• Calculated Molecular Weight: 371 aa, 40 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC112181
• Gene Symbol: AVPR2
• Gene ID (NCBI): 554
• RRID: AB_3742249
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30518
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AVPR2 is a Gs-coupled vasopressin receptor essential for renal water reabsorption, acting through cAMP-PKA-dependent trafficking of aquaporin-2. Localized to principal cells of the collecting duct, AVPR2 integrates hormonal cues to maintain osmotic and fluid homeostasis. Mutations lead to X-linked nephrogenic diabetes insipidus, while rare activating variants cause SIADH. Because of its central role in renal physiology and clear clinical associations, AVPR2 is a key target in water-balance disorders and pharmacologic modulation of diuresis.