AWAT1 Polyclonal antibody

• 

  WB analysis using 24704-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24704-1-AP (AWAT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 24704-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 24704-1-AP (AWAT1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

AWAT1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24704-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

DGA2, DGAT2L3

---

Tested Applications

• Positive WB detected in: HEK-293 cells, 3T3-L1 cells, NIH/3T3 cells
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24704-1-AP targets AWAT1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20183

  Product name: Recombinant human AWAT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 134-195 aa of BC153034

  Sequence: LATLSWFFKIPFVREYLMAKGVCSVSQPAINYLLSHGTGNLVGIVVGGVGEALQSVPNTTTL

• Full Name: acyl-CoA wax alcohol acyltransferase 1
• Calculated Molecular Weight: 328 aa, 38 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC153034
• Gene Symbol: AWAT1
• Gene ID (NCBI): 158833
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q58HT5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AWAT1 is an ER-localized acyltransferase specialized for wax ester biosynthesis in sebaceous and meibomian glands. By esterifying long-chain fatty acyl-CoAs with fatty alcohols, AWAT1 generates crucial lipids that maintain skin barrier function, sebaceous secretion, and tear film stability. Dysregulation of AWAT1 contributes to meibomian gland dysfunction, dry eye disease, and sebaceous lipid imbalance, positioning AWAT1 as a key enzymatic regulator of surface lipid homeostasis.