Rat Adiponectin Recombinant monoclonal antibody, PBS Only (Detector)

Adiponectin Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 83525-2-PBS
Clone No.240392D6

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

Adipoq, 240392D6, Acdc, Acrp30

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83525-2-PBS targets Adiponectin as part of a matched antibody pair:

MP00522-1: 83525-3-PBS capture and 83525-2-PBS detection (validated in Cytometric bead array)

MP00522-2: 83525-1-PBS capture and 83525-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0872

Product name: Recombinant Rat Adiponectin protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 19-244 aa of NM_144744.3

Sequence: ITATEGPGALVPPPKETCAGWMAGIPGYPGHNGIPGRDGRDGTPGEKGEKGDAGVLGPKGDPGDAGMTGAEGPRGFPGTPGRKGEPGEAAYMYHSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSMLLHLEVGDQVWLQVYGEGDNNGLYADNVNDSTFTGFLLYHDTN

Predict reactive species
Full Name adiponectin, C1Q and collagen domain containing
Calculated Molecular Weight26 kDa
Observed Molecular Weight26-28 kDa
GenBank Accession NumberNM_144744.3
Gene Symbol Adiponectin
Gene ID (NCBI) 246253
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8K3R4
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Adiponectin (AdipoQ), an adipocyte-derived hormone, is one of the most abundant adipokines in the blood circulation. Adiponectin modulates a number of metabolic processes, including improving INS sensitivity and anti-inflammatory activity. The role of AdipoQ in reproduction is not yet fully understood, but the expression of AdipoQ in reproductive tissues has been observed in various animals and humans, including chicken testis, bovine ovary, and human placenta. Adiponectin exerts its effects by activating a range of different signaling molecules via binding to two transmembrane AdipoQ receptors, AdipoR1 and AdipoR2. AdipoR1 is expressed primarily in the skeletal muscle, whereas AdipoR2 is predominantly expressed in the liver. AdipoQ May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors.

Loading...
||
New chat

Able

正在加载,请稍候...