Product Information
67743-2-PBS targets AgBR1 as part of a matched antibody pair:
MP50131-1: 67743-2-PBS capture and 67743-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | Mosquito |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30168 Product name: Recombinant mosquito AgBR1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 240-365 aa of XM_001844620 Sequence: AFLLKDSVEYVHLAAFDQKTPERNPSEADYTSPLYEPTGDGERIAANNVDAEVRYWLTNKTPPNKIVVGIASYGRGWKLPEDSGPVPPVTVDGPSPAGPYTNESGRYSYAEICTQLPGSRLSTLDG Predict reactive species |
| Full Name | AgBR1 |
| Calculated Molecular Weight | 49 kDa |
| GenBank Accession Number | XM_001844620 |
| Gene Symbol | AgBR1 |
| Gene ID (NCBI) | 6034353 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | B0W7I8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
