Alpha-1-microglobulin Polyclonal antibody

Alpha-1-microglobulin Polyclonal Antibody for WB, IHC, ELISA
Cat No. 26716-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

AMBP, ENZYME, Alpha 1-microglobulin, Alpha 1 microglycoprotein, Alpha 1 microglobulin

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman plasma, human urine
Positive IHC detected inhuman intrahepatic cholangiocarcinoma tissue, human stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26716-1-AP targets Alpha-1-microglobulin in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25239

Product name: Recombinant human AMBP protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 21-352 aa of BC041593

Sequence: PVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN

Predict reactive species
Full Name alpha-1-microglobulin/bikunin precursor
Calculated Molecular Weight 352 aa, 39 kDa
Observed Molecular Weight30 kDa
GenBank Accession NumberBC041593
Gene Symbol Alpha 1 microglobulin
Gene ID (NCBI) 259
RRIDAB_3085894
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP02760
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Alpha-1-microglobulin (A1M) is also named as Protein AMBP, Bikunin, Trypstatin and Inter-alpha-trypsin inhibitor light chain (ITI-LC). A1M belongs to the lipocalin protein family, a group of structural proteins with a similar one-domain fold that are found in bacteria, plants and animals (PMID: 2580349). A1M is recognized as a physiological antioxidant with powerful cell- and tissue-protective properties (PMID: 11877257). Whereas A1M is a heme and radical scavenger, and a reductase, bikunin is a structural component of extracellular matrix and has protease inhibitor and anti-inflammatory properties (PMID: 27988357). In humans, the majority of A1M is synthesized in the liver, but smaller quantities are also expressed in most other cells in the body. In the blood, equal quantities of two forms of A1M can be found: a free monomeric form and a covalent high-molecular weight complex bound to immunoglobulin A, albumin and prothrombin (PMID: 6196366, PMID: 9183005). Endogenous A1M has also been described to be localized ubiquitously in the dermal and epidermal layers of skin, and in syncytiothrophoblasts, monocytes/macrophages, vascular endothelium and extracellular matrix of placental tissue and extracellular matrix (PMID: 22096585,PMID: 21356557). Alpha 1 microglobulin, also known as HI30, is a 27-30 kDa glycoprotein, present in various body fluids. It belongs to the lipocalin superfamily of hydrophobic ligand-binding proteins forming an internal ligand-binding pocket. The protein acts as a mediator of bacterial adhesion to polymer surfaces and is involved in inhibiting renal lithogenesis.

Protocols

Product Specific Protocols
IHC protocol for Alpha-1-microglobulin antibody 26716-1-APDownload protocol
WB protocol for Alpha-1-microglobulin antibody 26716-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...