Use Able AI chat for product recommendations

Alpha-1-microglobulin Monoclonal antibody, PBS Only

Alpha-1-microglobulin Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 61038-2-PBS
Clone No.2A9H5

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

AMBP, A1M, Alpha 1 microglobulin, Alpha 1 microglycoprotein, Alpha 1-microglobulin

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

61038-2-PBS targets Alpha-1-microglobulin in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag37772

Product name: Recombinant human AMBP protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 206-352 aa of BC041593

Sequence: AVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN

Predict reactive species
Full Name alpha-1-microglobulin/bikunin precursor
Calculated Molecular Weight 352 aa, 39 kDa
Observed Molecular Weight30-39 kDa
GenBank Accession NumberBC041593
Gene Symbol Alpha 1 microglobulin
Gene ID (NCBI) 259
RRIDAB_3743265
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP02760
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Alpha-1-microglobulin (A1M) is also named as Protein AMBP, Bikunin, Trypstatin and Inter-alpha-trypsin inhibitor light chain (ITI-LC). A1M belongs to the lipocalin protein family, a group of structural proteins with a similar one-domain fold that are found in bacteria, plants and animals (PMID: 2580349). A1M is recognized as a physiological antioxidant with powerful cell- and tissue-protective properties (PMID: 11877257). Whereas A1M is a heme and radical scavenger, and a reductase, bikunin is a structural component of extracellular matrix and has protease inhibitor and anti-inflammatory properties (PMID: 27988357). In humans, the majority of A1M is synthesized in the liver, but smaller quantities are also expressed in most other cells in the body. In the blood, equal quantities of two forms of A1M can be found: a free monomeric form and a covalent high-molecular weight complex bound to immunoglobulin A, albumin and prothrombin (PMID: 6196366, PMID: 9183005). Endogenous A1M has also been described to be localized ubiquitously in the dermal and epidermal layers of skin, and in syncytiothrophoblasts, monocytes/macrophages, vascular endothelium and extracellular matrix of placental tissue and extracellular matrix (PMID: 22096585,PMID: 21356557). Alpha 1 microglobulin, also known as HI30, is a 27-30 kDa glycoprotein, present in various body fluids. It belongs to the lipocalin superfamily of hydrophobic ligand-binding proteins forming an internal ligand-binding pocket. The protein acts as a mediator of bacterial adhesion to polymer surfaces and is involved in inhibiting renal lithogenesis.

Loading...
||
New chat

Able

正在加载,请稍候...