Alpha-1-microglobulin Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of human plasma using 83678-3-RR (same clone as 83678-3-PBS)

  human plasma were subjected to SDS PAGE followed by western blot with 83678-3-RR (Alpha-1-microglobulin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83678-3-PBS in a different storage buffer formulation.

• 

  WB analysis of human urine using 83678-3-RR (same clone as 83678-3-PBS)

  human urine sample were subjected to SDS PAGE followed by western blot with 83678-3-RR (Alpha-1-microglobulin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83678-3-PBS in a different storage buffer formulation.

• 

  FC experiment of MCF-7 using 83678-3-RR (same clone as 83678-3-PBS)

  1x10^6 MCF-7 cells were intracellularly stained with 0.25 ug Alpha 1 microglobulin Recombinant antibody (83678-3-RR, Clone:240751G7) and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83678-3-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 83678-3-RR (same clone as 83678-3-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug Alpha 1 microglobulin Recombinant antibody (83678-3-RR, Clone:240751G7) and PE-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83678-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83678-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83678-3-RR against Human Alpha 1 microglobulin were performed. The affinity constant is 6.59 nM.

Alpha-1-microglobulin Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 83678-3-PBS

Clone No.240751G7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

Synonyms

AMBP, 240751G7, A1M, Alpha 1 microglobulin, Alpha 1 microglycoprotein

---

Product Information

83678-3-PBS targets Alpha-1-microglobulin in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1127

  Product name: Recombinant Human Alpha-1-microglobulin protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 20-203 aa of NM_001633.4

  Sequence: GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRV

• Full Name: alpha-1-microglobulin/bikunin precursor
• Calculated Molecular Weight: 39kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: NM_001633.4
• Gene Symbol: Alpha 1 microglobulin
• Gene ID (NCBI): 259
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P02760
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Alpha 1 microglobulin, also known as HI30, is a 27-30 kDa glycoprotein, present in various body fluids. It belongs to the lipocalin superfamily of hydrophobic ligand-binding proteins forming an internal ligand-binding pocket. The protein acts as a mediator of bacterial adhesion to polymer surfaces and is involved in inhibiting renal lithogenesis.