Alpha Adaptin Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Alpha Adaptin Polyclonal antibody, PBS Only (11401-1-PBS)

• 

  WB analysis of HEK-293 using 11401-1-AP (same clone as 11401-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 11401-1-AP (alpha Adaptin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11401-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human spleen using 11401-1-AP (same clone as 11401-1-PBS)

  human spleen tissue were subjected to SDS PAGE followed by western blot with 11401-1-AP (alpha Adaptin antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11401-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 11401-1-AP (same clone as 11401-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 11401-1-AP (alpha Adaptin antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11401-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 11401-1-AP (same clone as 11401-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor using 11401-1-AP (alpha Adaptin antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11401-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 11401-1-AP (same clone as 11401-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using Alpha Adaptin antibody (11401-1-AP) at dilution of 1:100 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 11401-1-PBS in a different storage buffer formulation.

Alpha Adaptin Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 11401-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

AP2A1, Alpha1 adaptin, Alpha adaptin A, ADTAA, Adaptor-related protein complex 2 subunit alpha-1

---

Product Information

11401-1-PBS targets Alpha Adaptin in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1927

  Product name: Recombinant human AP2A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 677-982 aa of BC014214

  Sequence: GAGNLLVDVFDGPAAQPSLGPTPEEAFLSPGPEDIGPPIPEADELLNKFVCKNNGVLFENQLLQIGVKSEFRQNLGRMYLFYGNKTSVQFQNFSPTVVHPGDLQTQLAVQTKRVAAQVDGGAQVQQVLNIECLRDFLTPPLLSVRFRYGGAPQALTLKLPVTINKFFQPTEMAAQDFFQRWKQLSLPQQEAQKIFKANHPMDAEVTKAKLLGFGSALLDNVDPNPGDREDTRVWGMPGTFLRPFVFLFLFICCCLHSGGLGGVPLPPFPPQAQRGEGPGKWMSPPLPPHPVVAPPTPSPSRGCVLL

• Full Name: adaptor-related protein complex 2, alpha 1 subunit
• Calculated Molecular Weight: 977 aa, 108 kDa
• Observed Molecular Weight: 108 kDa
• GenBank Accession Number: BC014214
• Gene Symbol: AP2A1
• Gene ID (NCBI): 160
• RRID: AB_2056316
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95782
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AP2A1 encodes adaptor protein complex 2 (AP-2) subunit alpha-1, which is a 100 kDa coated vesicle protein. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP complexes are involved in the formation of clathrin-coated vesicles (CCVs) by recruiting the scaffold protein, clathrin. AP complexes also play a pivotal role in the cargo selection by recognizing the sorting signals within the cytoplasmic tail of integral membrane proteins. AP-2 is involved in clathrin-dependent endocytosis.