Alpha B Crystallin Monoclonal antibody, PBS Only

Alpha B Crystallin Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 68001-1-PBS
Clone No.1B4C3

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Alpha crystallin B chain, Alpha(B) crystallin, CRYA2, CRYAB, crystallin, alpha B, CTPP2, Heat shock protein beta 5, HSPB5, Rosenthal fiber component

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68001-1-PBS targets Alpha B Crystallin in WB, IHC, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8656

Product name: Recombinant human aB-Crystallin protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-175 aa of BC007008

Sequence: MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK

Predict reactive species
Full Name crystallin, alpha B
Calculated Molecular Weight 175 aa, 20 kDa
Observed Molecular Weight20-22 kDa
GenBank Accession NumberBC007008
Gene Symbol Alpha B Crystallin
Gene ID (NCBI) 1410
RRIDAB_2918749
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP02511
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Alpha B-crystallin, encoded by CRYAB gene, is multifunctional, serving as both a major structural protein in the lens and a small heat-shock protein in other tissues in mammals. Alpha B-crystallin may contribute to the transparency and refractive index of the lens. Single nucleotide polymorphisms (SNPs) in the promoter region of CRYAB gene have been associated with in multiple sclerosis. Mutations in the CRYAB gene cause distinct clinical phenotypes including isolated posterior polar cataract, myofibrillar myopathy, cardiomyopathy, or a multisystemic disorder combining all these features. Impairment of alpha-B crystallin dimerization may be relevant to the pathogenesis of these disorders.

Loading...
||
New chat Able
正在加载,请稍候...