Alpha Internexin Polyclonal antibody, PBS Only

• 

  WB analysis using 23881-1-AP (same clone as 23881-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 23881-1-AP (alpha-internexin antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23881-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 23881-1-AP (same clone as 23881-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 23881-1-AP (alpha-internexin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23881-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 23881-1-AP (same clone as 23881-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 23881-1-AP (alpha-internexin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23881-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 23881-1-AP (same clone as 23881-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 23881-1-AP (alpha-internexin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23881-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 23881-1-AP (same clone as 23881-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 23881-1-AP (alpha-internexin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23881-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 23881-1-AP (same clone as 23881-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 23881-1-AP (alpha-internexin antibody at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 23881-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 23881-1-AP (same clone as 23881-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 23881-1-AP (alpha-internexin antibody at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 23881-1-PBS in a different storage buffer formulation.

Alpha Internexin Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 23881-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

INA, 66 kDa neurofilament protein, Alpha Inx, Alpha-internexin, Alpha-Inx

---

Product Information

23881-1-PBS targets Alpha Internexin in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20844

  Product name: Recombinant human INA protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-300 aa of BC006359

  Sequence: MSFGSEHYLCSSSSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSLGLGLAYRRPPASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQRHAEPSRVGELFQRELRDLRAQLEEASSARSQALLERDGLAEEVQRLRARCEEESRGREGAERALKAQQRDVDGATLARLDLEKKVESLLDELAFVRQVHDEEVAELLATLQASSQAAAEVDVTVAKPDLTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAAR

• Full Name: internexin neuronal intermediate filament protein, alpha
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 66-68 kDa
• GenBank Accession Number: BC006359
• Gene Symbol: INA
• Gene ID (NCBI): 9118
• RRID: AB_2879348
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16352
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.