Angptl4 Polyclonal antibody

Angptl4 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 51109-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Hepatic fibrinogen/angiopoietin-related protein, ANGPTL4 N-terminal chain, ANGPTL4 C-terminal chain, Angiopoietin-related protein 4, Angiopoietin-like protein 4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue
Positive IHC detected inhuman kidney tissue, rat kidney tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

51109-1-AP targets Angptl4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0613

Product name: Recombinant rat Angptl4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-405 aa of BC078944

Sequence: MRCAPTAGAALVLCAATAGLLSAQGRPAQPEPPRFASWDEMNLLAHGLLQLGHGLREHVERTRGQLGALERRMAACGNACQGPKGTDPKDRVPEGQAPETLQSLQTQLKAQNSKIQQLFQKVAQQQRYLSKQNLRIQNLQSQIDLLTPTHLDNGVDKTSRGKRLPKMAQLIGLTPNATRLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGDRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQQRKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS

Predict reactive species
Full Name angiopoietin-like 4
Calculated Molecular Weight 405 aa, 45 kDa
GenBank Accession NumberBC078944
Gene Symbol Angptl4
Gene ID (NCBI) 362850
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6TMA8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Angiopoietin-like protein 4 (ANGPTL4), a member of the angiopoietin-like protein subfamily, is a secretory protein that functions as an important modulator of glucose and lipid metabolism. ANGPTL4 inhibits lipoprotein lipase (LPL)-dependent lipolysis thereby limiting the uptake of free fatty acids. Overexpression of ANGPTL4 results in hypertriglyceridemia, while ANGPTL4 deficiency suppresses foam formation in macrophages and protects against atherosclerosis. ANGPTL4 may play a role in several cancers and it also has been shown to prevent the metastatic process by inhibiting vascular activity as well as tumor cell motility and invasiveness. Decreased expression of this protein has been associated with type 2 diabetes. ANGPTL4 has three functional domains: the signal peptide, the coiled-coil (N-terminal chain, CCD), and the fibrinogen-like (C-terminal chain, FLD) domains. ANGPTL4 is a glycosylated secreted protein (fANGPTL4, 45-65 kDa). fANGPTL is then rapidly post-translationally cleaved into an N-terminal coiled-coil domain (nANGPTL4, ~ 15 kDa) and a C-terminal fibrinogen-like domain (cANGPTL4, ~ 35 kDa)(PMID: 37300585 ).

Protocols

Product Specific Protocols
IHC protocol for Angptl4 antibody 51109-1-APDownload protocol
WB protocol for Angptl4 antibody 51109-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human,mouseIF

Theranostics

Advancing the clinical assessment of glomerular podocyte pathology in kidney biopsies via super-resolution microscopy and angiopoietin-like 4 staining

Authors - Xiaojing Liu
  • KO Validated
Loading...
||
New chat Able
正在加载,请稍候...