Annexin A11 Monoclonal antibody, PBS Only

Annexin A11 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA
Cat No. 68089-1-PBS
Clone No.1A3C4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

ANXA11, 1A3C4, 56 kDa autoantigen, Annexin 11, Annexin XI

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68089-1-PBS targets Annexin A11 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag31839

Product name: Recombinant human ANXA11 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-180 aa of BC007564

Sequence: MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANMPNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQPPGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVT

Predict reactive species
Full Name annexin A11
Calculated Molecular Weight 56 kDa
Observed Molecular Weight 56 kDa
GenBank Accession NumberBC007564
Gene Symbol Annexin A11
Gene ID (NCBI) 311
RRIDAB_2918826
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP50995
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Annexin A11 (Anxa11) is one member of annexins that are Ca2+-regulated phospholipid-binding proteins. Annexin A11 plays an important role in cell division, differentiation, apoptosis, vesicle trafficking and Ca2+ signaling (PMID: 31610865). ANXA11, an RNA granule-associated phosphoinositide-binding protein, acts as a molecular tether between RNA granules and lysosomes (PMID: 31539493). Annexin A11 dysregulation is involved in the progression, drug-resistance, recurrence of systemic autoimmune disease and cancer. Annexin A11, is involved in a variety of cellular functions including mRNA transport and translation, endocytosis, exocytosis, and plasma membrane repair (PMID: 38896345).

Loading...
||
New chat Able
正在加载,请稍候...