Annexin A11 Monoclonal antibody, PBS Only

• 

  WB analysis using 68089-1-Ig (same clone as 68089-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68089-1-Ig (Annexin A11 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68089-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 68089-1-Ig (same clone as 68089-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 68089-1-Ig (Annexin A11 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68089-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 68089-1-Ig (same clone as 68089-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 68089-1-Ig (Annexin A11 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68089-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 68089-1-Ig (same clone as 68089-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 68089-1-Ig (Annexin A11 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68089-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 68089-1-Ig (same clone as 68089-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 68089-1-Ig (Annexin A11 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68089-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 68089-1-Ig (same clone as 68089-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using Annexin A11 antibody (68089-1-Ig, Clone: 1A3C4 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68089-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HEK-293T using 68089-1-Ig (same clone as 68089-1-PBS)

  1X10^6 HEK-293T cells were intracellularly stained with 0.4 ug Anti-Human Annexin A11 (68089-1-Ig, Clone:1A3C4) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 68089-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 68089-1-Ig (same clone as 68089-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human Annexin A11 (68089-1-Ig, Clone:1A3C4) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 68089-1-PBS in a different storage buffer formulation.

Annexin A11 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 68089-1-PBS

Clone No.1A3C4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

ANXA11, 1A3C4, 56 kDa autoantigen, Annexin 11, Annexin XI

---

Product Information

68089-1-PBS targets Annexin A11 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31839

  Product name: Recombinant human ANXA11 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-180 aa of BC007564

  Sequence: MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANMPNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQPPGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVT

• Full Name: annexin A11
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC007564
• Gene Symbol: Annexin A11
• Gene ID (NCBI): 311
• RRID: AB_2918826
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P50995
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Annexin A11 (Anxa11) is one member of annexins that are Ca2+-regulated phospholipid-binding proteins. Annexin A11 plays an important role in cell division, differentiation, apoptosis, vesicle trafficking and Ca2+ signaling (PMID: 31610865). ANXA11, an RNA granule-associated phosphoinositide-binding protein, acts as a molecular tether between RNA granules and lysosomes (PMID: 31539493). Annexin A11 dysregulation is involved in the progression, drug-resistance, recurrence of systemic autoimmune disease and cancer. Annexin A11, is involved in a variety of cellular functions including mRNA transport and translation, endocytosis, exocytosis, and plasma membrane repair (PMID: 38896345).