Annexin A4 Polyclonal antibody

Annexin A4 Polyclonal Antibody for WB, ELISA
Cat No. 29508-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, rat, mouse

Applications

WB, ELISA

35 beta calcimedin, Annexin 4, annexin A4, Annexin IV, ANX4, ANXA4, Chromobindin 4, DKFZp686H02120, Endonexin I, Lipocortin IV, P32.5, PAP II, PIG28, PP4 X, Protein II, ZAP36

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, mouse kidney tissue, mouse liver tissue, mouse lung tissue, rat kidney tissue, NIH/3T3 cells, RAW 264.7 cells, HuH-7 cells, PC-12 cells, C6 cells, human placenta tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

29508-1-AP targets Annexin A4 in WB, ELISA applications and shows reactivity with Human, rat, mouse samples.

Tested Reactivity Human, rat, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag30827

Product name: Recombinant human Annexin IV protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 118-274 aa of BC000182

Sequence: RTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVM

Predict reactive species
Full Name annexin A4
Calculated Molecular Weight 36 kDa
Observed Molecular Weight36 kDa
GenBank Accession NumberBC000182
Gene Symbol Annexin A4
Gene ID (NCBI) 307
RRIDAB_2918319
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP09525
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Annexin A4 (Anxa4) is one of the Ca2 +-regulated and phospholipid-binding annexin superfamily proteins, and is located at 2p13. Anxa4 has a potential role in diagnosis, prognosis, and treatment of certain cancers. Annexin A4 shares 45 to 59% identity with other members and possibly interacts with ATP. Annexin A4 has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. The Annexin A4 protein is expressed in a wide range of tissues, associated with polarized epithelial cells and is proposed to be involved in the regulation of chloride ions across the epithelial membrane.

Protocols

Product Specific Protocols
WB protocol for Annexin A4 antibody 29508-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...