Annexin A4 Polyclonal antibody

• 

  WB analysis using 29508-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29508-1-AP (Annexin A4 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 29508-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29508-1-AP (Annexin IV antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

Annexin A4 Polyclonal Antibody for WB, ELISA

Cat No. 29508-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, rat, mouse

Applications

WB, ELISA

Synonyms

35 beta calcimedin, Annexin 4, annexin A4, Annexin IV, ANX4, ANXA4, Chromobindin 4, DKFZp686H02120, Endonexin I, Lipocortin IV, P32.5, PAP II, PIG28, PP4 X, Protein II, ZAP36

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, mouse kidney tissue, mouse liver tissue, mouse lung tissue, rat kidney tissue, NIH/3T3 cells, RAW 264.7 cells, HuH-7 cells, PC-12 cells, C6 cells, human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29508-1-AP targets Annexin A4 in WB, ELISA applications and shows reactivity with Human, rat, mouse samples.

• Tested Reactivity: Human, rat, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30827

  Product name: Recombinant human Annexin IV protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 118-274 aa of BC000182

  Sequence: RTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVM

• Full Name: annexin A4
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC000182
• Gene Symbol: Annexin A4
• Gene ID (NCBI): 307
• RRID: AB_2918319
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P09525
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Annexin A4 (Anxa4) is one of the Ca2 +-regulated and phospholipid-binding annexin superfamily proteins, and is located at 2p13. Anxa4 has a potential role in diagnosis, prognosis, and treatment of certain cancers. Annexin A4 shares 45 to 59% identity with other members and possibly interacts with ATP. Annexin A4 has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. The Annexin A4 protein is expressed in a wide range of tissues, associated with polarized epithelial cells and is proposed to be involved in the regulation of chloride ions across the epithelial membrane.