Annexin A4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Annexin A4 Polyclonal antibody (29508-1-AP)

• KD/KO Validated

Annexin A4 Polyclonal Antibody for WB, ELISA

Cat No. 29508-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

ANXA4, 35 beta calcimedin, 35-beta calcimedin, Annexin 4, Annexin IV

• 

  WB analysis using 29508-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29508-1-AP (Annexin A4 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 29508-1-AP

  WB result of Annexin A4 antibody (29508-1-AP; 1:12000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Annexin A4 transfected HeLa cells.

• 

  WB analysis using 29508-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29508-1-AP (Annexin IV antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, mouse kidney tissue, mouse liver tissue, mouse lung tissue, rat kidney tissue, NIH/3T3 cells, RAW 264.7 cells, HuH-7 cells, PC-12 cells, C6 cells, human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29508-1-AP targets Annexin A4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30827

  Product name: Recombinant human Annexin IV protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 118-274 aa of BC000182

  Sequence: RTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVM

• Full Name: annexin A4
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC000182
• Gene Symbol: Annexin A4
• Gene ID (NCBI): 307
• RRID: AB_2918319
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P09525
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Annexin A4 (Anxa4) is one of the Ca2 +-regulated and phospholipid-binding annexin superfamily proteins, and is located at 2p13. Anxa4 has a potential role in diagnosis, prognosis, and treatment of certain cancers. Annexin A4 shares 45 to 59% identity with other members and possibly interacts with ATP. Annexin A4 has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. The Annexin A4 protein is expressed in a wide range of tissues, associated with polarized epithelial cells and is proposed to be involved in the regulation of chloride ions across the epithelial membrane.