Product Information
87100-1-PBS targets Apolipoprotein CIII in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg3387 Product name: Recombinant Human Apolipoprotein CIII protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 21-99 aa of NM_000040 Sequence: SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA Predict reactive species |
| Full Name | apolipoprotein C-III |
| Calculated Molecular Weight | 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | NM_000040 |
| Gene Symbol | Apolipoprotein CIII |
| Gene ID (NCBI) | 345 |
| RRID | AB_3745339 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P02656 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Apolipoprotein CIII (apoCIII) is the most abundant C-apolipoprotein in human and is found on very low density lipoproteins, chylomicrons, and high density lipoproteins (HDL) (PMID: 18408013). ApoCIII inhibits lipoprotein lipase as well as binding of lipoproteins to cell surface heparan sulfate proteoglycans and receptors (PMID: 26228667). ApoC-III has 3 actions that can impair plasma lipoprotein metabolism and lead to hypertriglyceridemia (PMID: 24941081).







