Apolipoprotein CIII Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87100-1-RR (same clone as 87100-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87100-1-RR (Apolipoprotein CIII antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87100-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 87100-1-RR (same clone as 87100-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87100-1-RR (Apolipoprotein CIII antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87100-1-PBS in a different storage buffer formulation.

• 

  IF Staining of L02 using 87100-1-RR (same clone as 87100-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed L02 cells using Apolipoprotein CIII antibody (87100-1-RR, Clone: 252153H5 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 87100-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 87100-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87100-1-RR against Human Apolipoprotein CIII were performed. The affinity constant is below 1 pM.

Apolipoprotein CIII Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 87100-1-PBS

Clone No.252153H5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

APOC3, Apo CIII, ApoC III, APOCIII, Apo-CIII

---

Product Information

87100-1-PBS targets Apolipoprotein CIII in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3387

  Product name: recombinant human APOC3 protein

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 21-99 aa of NM_000040

  Sequence: SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA

• Full Name: apolipoprotein C-III
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: NM_000040
• Gene Symbol: Apolipoprotein CIII
• Gene ID (NCBI): 345
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P02656
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Apolipoprotein CIII (apoCIII) is the most abundant C-apolipoprotein in human and is found on very low density lipoproteins, chylomicrons, and high density lipoproteins (HDL) (PMID: 18408013). ApoCIII inhibits lipoprotein lipase as well as binding of lipoproteins to cell surface heparan sulfate proteoglycans and receptors (PMID: 26228667). ApoC-III has 3 actions that can impair plasma lipoprotein metabolism and lead to hypertriglyceridemia (PMID: 24941081).