Use Able AI chat for product recommendations

APOE Polyclonal antibody

APOE Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 31454-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, ELISA

AI255918, apolipoprotein E

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU-251 cells, BV-2 cells, C2C12 cells, mouse brain tissue, mouse skeletal muscle tissue, mouse cerebellum tissue, rat brain tissue, pig cerebellum tissue
Positive IHC detected inrat cerebellum tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:300-1:1200
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

31454-1-AP targets APOE in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Eg1093

Product name: Recombinant Mouse APOE protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 19-311 aa of NM_001305819.1

Sequence: EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ

Predict reactive species
Full Name Apolipoprotein E
Calculated Molecular Weight36kDa
Observed Molecular Weight31~36 kDa
GenBank Accession NumberNM_001305819.1
Gene Symbol Apoe
Gene ID (NCBI) 11816
RRIDAB_3669993
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDP08226
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Apolipoprotein E (Apoe) is a core component of plasma lipoproteins that participates in diverse biological processes, including plasma lipoprotein metabolism, intracellular cholesterol utilization, cell growth, immunoregulation, and neuronal growth and repair (PMID: 17854398). Mouse apoE, like apoE4, contains the equivalent of Arg-112 and Glu-255, but lacks the critical Arg-61 equivalent (it contains Thr-61). Thus, mouse apoE does not display apoE4 domain interaction (PMID: 11553788).

Protocols

Product Specific Protocols
IF protocol for APOE antibody 31454-1-APDownload protocol
IHC protocol for APOE antibody 31454-1-APDownload protocol
WB protocol for APOE antibody 31454-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Zakia (Verified Customer) (08-04-2026)

Excellent primary antibody for Western blotting. We tested this APOE antibody on mouse brain tissue samples for our Alzheimer's disease study. The results were highly reproducible, showing a clear, well-defined band right in the expected 34–36 kDa range. We are very satisfied and will be purchasing this product again.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: mice brain sample
APOE Antibody Western Blot validation (1:2000 dilution) in mice brain sample (Cat no:31454-1-AP)

Andrea (Verified Customer) (07-24-2026)

It works very well by WB on astrocyte conditioned medium samples

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:20 000
  • Cell Tissue Type: astrocyte conditioned medium
Loading...
||
New chat

Able

正在加载,请稍候...