APOE Polyclonal antibody

• Home
• Products
• Primary Antibodies
• APOE Polyclonal antibody (31454-1-AP)

APOE Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 31454-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

AI255918, apolipoprotein E

• 

  WB analysis using 31454-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31454-1-AP (Apoe antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 31454-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31454-1-AP (Apoe antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat cerebellum using 31454-1-AP

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 31454-1-AP (Apoe antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat cerebellum using 31454-1-AP

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 31454-1-AP (Apoe antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 31454-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using Apoe antibody (31454-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

---

Tested Applications

• Positive WB detected in: U-251 cells, BV-2 cells, C2C12 cells, mouse brain tissue, mouse skeletal muscle tissue, mouse cerebellum tissue, rat brain tissue, pig cerebellum tissue
• Positive IHC detected in: rat cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31454-1-AP targets APOE in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg1093

  Product name: Recombinant Mouse APOE protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 19-311 aa of NM_001305819.1

  Sequence: EGEPEVTDQLEWQSNQPWEQALNRFWDYLRWVQTLSDQVQEELQSSQVTQELTALMEDTMTEVKAYKKELEEQLGPVAEETRARLGKEVQAAQARLGADMEDLRNRLGQYRNEVHTMLGQSTEEIRARLSTHLRKMRKRLMRDAEDLQKRLAVYKAGAREGAERGVSAIRERLGPLVEQGRQRTANLGAGAAQPLRDRAQAFGDRIRGRLEEVGNQARDRLEEVREHMEEVRSKMEEQTQQIRLQAEIFQARLKGWFEPIVEDMHRQWANLMEKIQASVATNPIITPVAQENQ

• Full Name: Apolipoprotein E
• Calculated Molecular Weight: 36kDa
• Observed Molecular Weight: 31~36 kDa
• GenBank Accession Number: NM_001305819.1
• Gene Symbol: Apoe
• Gene ID (NCBI): 11816
• RRID: AB_3669993
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P08226
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Apolipoprotein E (Apoe) is a core component of plasma lipoproteins that participates in diverse biological processes, including plasma lipoprotein metabolism, intracellular cholesterol utilization, cell growth, immunoregulation, and neuronal growth and repair (PMID: 17854398). Mouse apoE, like apoE4, contains the equivalent of Arg-112 and Glu-255, but lacks the critical Arg-61 equivalent (it contains Thr-61). Thus, mouse apoE does not display apoE4 domain interaction (PMID: 11553788).

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Andrea (Verified Customer) (07-24-2026)

It works very well by WB on astrocyte conditioned medium samples

• Applications: Western Blot
• Primary Antibody Dilution: 1:20 000
• Cell Tissue Type: astrocyte conditioned medium