Beta Arrestin 1 Recombinant monoclonal antibody, PBS Only (Detector)

Beta Arrestin 1 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 83837-1-PBS
Clone No.240974C3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

ARRB1, 240974C3, ARB 1, ARB1, ARB2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83837-1-PBS targets Beta Arrestin 1 as part of a matched antibody pair:

MP00811-2: 83837-2-PBS capture and 83837-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7608

Product name: Recombinant human Arrestin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 69-418 aa of BC003636

Sequence: DVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR

Predict reactive species
Full Name arrestin, beta 1
Calculated Molecular Weight 47 kDa
Observed Molecular Weight47-55 kDa
GenBank Accession NumberBC003636
Gene Symbol Beta Arrestin 1
Gene ID (NCBI) 408
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP49407
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

β-Arrestins (ARRBs), the best known regulators of G protein-coupled receptor signaling, are versatile and multifunctional adapter proteins that regulate diverse cellular functions, including cell growth, apoptosis and immune responses. Overexpression of beta Arrestin 1 has been found in various cancers, indicating it as a potential therapeutic target for cancer treatment. Recently expression of ARRB1 in saliva has been identified as a candidate circadian biomarker. ARRB1 migrated as a doublet of two bands of 45 and 55 kDa (PMID:28947386).

Loading...
||
New chat

Able

正在加载,请稍候...