Arrestin C Recombinant monoclonal antibody, PBS Only

Arrestin C Uni-rAb® Recombinant Antibody for WB, IF-P, Indirect ELISA
Cat No. 85067-5-PBS
Clone No.242751B12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, Indirect ELISA

Arrestin-C, ARR3, C-arrestin, CAR, ARRX

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85067-5-PBS targets Arrestin C in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1580

Product name: Recombinant human ARR3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-300 aa of BC012096

Sequence: MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYFKCRKLFVMLTCAFRYGRDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASS

Predict reactive species
Full Name arrestin 3, retinal (X-arrestin)
Calculated Molecular Weight 43 kDa
Observed Molecular Weight47-50 kDa
GenBank Accession NumberBC012096
Gene Symbol Arrestin C
Gene ID (NCBI) 407
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP36575
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Arrestin C, also known as Arrestin 3 or Retinal Cone Arrestin, is a protein encoded by the ARR3 gene. It belongs to the arrestin family, which plays a crucial role in regulating G-protein-coupled receptor (GPCR) signaling and trafficking. Arrestin C is composed of two major domains: the N-domain and the C-domain, connected by a hinge region. These domains form a structure resembling two clamshells placed end-to-end. The C-terminal tail (C-tail) of Arrestin C interacts extensively with the N-domain, stabilizing its basal conformation. Arrestin C is predominantly expressed in cone photoreceptors and pinealocytes in the retina. It is involved in the shut-off mechanisms associated with high-acuity color vision by binding to phosphorylated and activated opsins, thereby inhibiting their ability to interact with transducin.

Loading...
||
New chat

Able

正在加载,请稍候...