B3GALTL Polyclonal antibody

• 

  WB analysis of human heart using 14601-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 14601-1-AP (B3GALTL antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 14601-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 14601-1-AP (B3GALTL antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human endometrial cancer using 14601-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 14601-1-AP (B3GALTL antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human endometrial cancer using 14601-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer using 14601-1-AP (B3GALTL antibody) at dilution of 1:50 (under 40x lens).

B3GALTL Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14601-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

B3GALTL, B3Glc T, B3GLCT, B3GTL, Beta 1,3 glucosyltransferase, beta3Glc T, Gal T

---

Tested Applications

• Positive WB detected in: human heart tissue, mouse skeletal muscle tissue
• Positive IHC detected in: human endometrial cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14601-1-AP targets B3GALTL in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6146

  Product name: Recombinant human B3GALTL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 199-498 aa of BC068595

  Sequence: KLTKRLKSESLKSDFTIDLKHEIALYIWDKGGGPPLTPVPEFCTNDVDFYCATTFHSFLPLCRKPVKKKDIFVAVKTCKKFHGDRMPIVKQTWESQASLIEYYSDYTENSIPTVDLGIPNTDRGHCGKTFAILERFLNRSQDKTAWLVIVDDDTLISISRLQHLLSCYDSGKPVFLGERYGYGLGTGGYSYITGGGGMVFSREAVRRLLASKCRCYSNDAPDDMVLGMCFSGLGIPVTHSPLFHQARPVDYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQETQKGFREEL

• Full Name: beta 1,3-galactosyltransferase-like
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC068595
• Gene Symbol: B3GALTL
• Gene ID (NCBI): 145173
• RRID: AB_2063186
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6Y288
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.