B3GAT2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• B3GAT2 Polyclonal antibody, PBS Only (24631-1-PBS)

• 

  WB analysis using 24631-1-AP (same clone as 24631-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24631-1-AP (B3GAT2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24631-1-PBS in a different storage buffer formulation.

B3GAT2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24631-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

24631-1-PBS targets B3GAT2 in WB, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18402

  Product name: Recombinant human B3GAT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 175-251 aa of BC113995

  Sequence: FAVSLQVILSNPKAVFKRRGSQPGMQESDFLKQITTVEELEPKANNCTKVLVWHTRTEKVNLANEPKYHLDTVKIEV

• Full Name: beta-1,3-glucuronyltransferase 2 (glucuronosyltransferase S)
• Calculated Molecular Weight: 323 aa, 37 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC113995
• Gene Symbol: B3GAT2
• Gene ID (NCBI): 135152
• RRID: AB_3085743
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NPZ5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.