B3GNT2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• B3GNT2 Polyclonal antibody (14200-1-AP)

B3GNT2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 14200-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

B3GALT7, b3Gal-T7, B3GNT1, Beta-1,3-galactosyltransferase 7, Beta-1,3-GalTase 7

• 

  WB analysis using 14200-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14200-1-AP (B3GNT2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14200-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14200-1-AP (B3GNT2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 14200-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 14200-1-AP (B3GNT2 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: Jurkat cells, SMMC-7721 cells, MCF-7 cells, mouse brain tissue, mouse testis tissue
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14200-1-AP targets B3GNT2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5404

  Product name: Recombinant human B3GNT2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 47-397 aa of BC030579

  Sequence: KFWKISTPPEAYWNREQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC

• Full Name: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45 kDa, 69 kDa
• GenBank Accession Number: BC030579
• Gene Symbol: B3GNT2
• Gene ID (NCBI): 10678
• RRID: AB_3085431
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NY97
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

β-1,3-N-acetylglucosaminyltransferase (B3GNT2) is the most abundant and ubiquitously expressed B3GNT isoform and displays the greatest in vitro activity for N-glycan and O-glycan poly-LacNAc extensionis. B3GNT2 encodes a poly-N-acetyllactosamine synthase that targets >10 ligands and receptors to disrupt interactions between tumor and T cells and reduce T cell activation (PMID: 35338135, 32663509). B3GNT2 also has five predicted N-glycosylation sites at asparagine residues 79, 89, 127, 173, and 219 (PMID: 33229435). Western blots indicated the glycosylated form of B3GNT2 is detected at ~ 67 kDa.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Biochim Biophys Acta Mol Basis Dis; B3GNT2 promotes gastric cancer metastasis by facilitating membrane trafficking of RYK via N-glycosylation.; Authors - Yongan Fu
human	WB	Front Immunol; Shared glycosylation-related molecular mechanism and immune infiltration patterns of fetal growth restriction and preeclampsia.; Authors - Tingxuan Yin