B4GALNT1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• B4GALNT1 Polyclonal antibody (13396-1-AP)

• Featured Product
• KD/KO Validated

B4GALNT1 Polyclonal Antibody for WB, ELISA

Cat No. 13396-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

B4GALNT1, GALGT, GalNAc T, GALNACT, GM2/GD2 synthase, SIAT2

• 

  WB analysis of COLO 320 using 13396-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 13396-1-AP (B4GALNT1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A375 using 13396-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 13396-1-AP (B4GALNT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: COLO 320 cells, A375 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13396-1-AP targets B4GALNT1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4065

  Product name: Recombinant human B4GALNT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-328 aa of BC029828

  Sequence: DAPGLRLPLAPWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNLTASLGTWDVAGEVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTGARPGWRDGQAGQTEKNQKGWSGQMAEGMGGIWAMARAVQPHNGCFNWTSRARGRKGAFVHLGLEQARGKPEPWVCLPFRPTVGGPRKRLV

• Full Name: beta-1,4-N-acetyl-galactosaminyl transferase 1
• Calculated Molecular Weight: 532 aa, 58 kDa
• Observed Molecular Weight: 67.5 kDa
• GenBank Accession Number: BC029828
• Gene Symbol: B4GALNT1
• Gene ID (NCBI): 2583
• RRID: AB_2061077
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q00973
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Nat Cell Biol; Mitochondrial fission links ECM mechanotransduction to metabolic redox homeostasis and metastatic chemotherapy resistance.; Authors - Patrizia Romani
Rat	WB	Cell Prolif; SCARF1 promotes M2 polarization of Kupffer cells via calcium-dependent PI3K-AKT-STAT3 signalling to improve liver transplantation.; Authors - Xue-Song Xu
rat	WB,IF,IP	iScience; Linking NMDA Receptor Synaptic Retention to Synaptic Plasticity and Cognition.; Authors - Luca Franchini
human	WB	Front Genet; Identification of a Novel Glycosyltransferase Prognostic Signature in Hepatocellular Carcinoma Based on LASSO Algorithm.; Authors - Zhiyang Zhou
human	WB,IHC	J Gene Med; B4GALNT1 promotes carcinogenesis by regulating epithelial-mesenchymal transition in hepatocellular carcinoma based on pan-cancer analysis; Authors - Wenli Liu ; KD Validated
human	WB	J Clin Lab Anal; B4GALNT1 Regulates Hepatocellular Carcinoma Cell Proliferation and Apoptosis via the PI3K-AKT-mTOR Pathway; Authors - Lihan Bie