B4GALT5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• B4GALT5 Polyclonal antibody (17846-1-AP)

B4GALT5 Polyclonal Antibody for WB, ELISA

Cat No. 17846-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

b4Gal-T5, Beta 1,4 GalTase 5, Beta-1,4-galactosyltransferase 5, Beta-1,4-GalT II, Beta-1,4-GalTase 5

• 

  WB analysis using 17846-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17846-1-AP (B4GALT5 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 17846-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17846-1-AP (B4GALT5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17846-1-AP targets B4GALT5 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12267

  Product name: Recombinant human B4GALT5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 44-388 aa of BC074873

  Sequence: FMMQAQGILIRDNVRTIGAQVYEQVLRSAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPEDFTYFANHTCPERLPSMKGPIDINMSEIGMDYIHELFSKDPTIKLGGHWKPSDCMPRWKVAILIPFRNRHEHLPVLFRHLLPMLQRQRLQFAFYVVEQVGTQPFNRAMLFNVGFQEAMKDLDWDCLIFHDVDHIPESDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLNYFANITYDALYKNITVNLTPELAQVNEY

• Full Name: UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5
• Calculated Molecular Weight: 388 aa, 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC074873
• Gene Symbol: B4GALT5
• Gene ID (NCBI): 9334
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43286
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

B4GALT5 (beta-1,4-galactosyltransferase 5) catalyzes the synthesis of lactosylceramide (LacCer) via the transfer of galactose from UDP-galactose to glucosylceramide (GlcCer). B4GALT5 is present on the cell surface and located in the Golgi complex, similar to other glycosyltransferases that function as adhesion molecules involved in matrix interactions, cell spreading and migration, and signal transduction cascades (PMID: 35410157).