CD86 Polyclonal antibody

• 

  WB analysis using 30691-1-AP

  DC2.4 cells were subjected to SDS PAGE followed by western blot with 30691-1-AP (CD86 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 30691-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30691-1-AP (CD86 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

CD86 Polyclonal Antibody for WB, ELISA

Cat No. 30691-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

B7, B7 2, B7.2, B70, B7-2

---

Tested Applications

• Positive WB detected in: DC2.4 cells, NR8383 cells, J774A.1 cells, RAW 264.7 cells, mouse spleen tissue, rat spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 2 publications below
• IF: See 8 publications below

Product Information

30691-1-AP targets CD86 in WB, IHC, IF, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33514

  Product name: Recombinant mouse Cd86 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-244 aa of NM_019388

  Sequence: VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWK

• Full Name: CD86 antigen
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: NM_019388
• Gene Symbol: Cd86
• Gene ID (NCBI): 12524
• RRID: AB_3086387
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P42082-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD86 (also known as B7-2) is a costimulatory molecule belonging to the immunoglobulin superfamily. Primarily expressed on antigen-presenting cells (APCs), including B cells, dendritic cells, and macrophages, CD86 is the ligand for two proteins at the cell surface of T cells, CD28 antigen and CTLA-4. Binding of CD86 with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of CD86 with CTLA-4 negatively regulates T-cell activation and diminishes the immune response. (PMID: 7513726; 1847722; 11029388; 27591335)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	J Inflamm Res; B Cell Activation, Differentiation, and Their Potential Molecular Mechanisms in Osteoarthritic Synovial Tissue; Authors - Peizhi Lu
mouse	IF	ACS Nano; Nicotinamide Adenine Dinucleotide-Loaded Lubricated Hydrogel Microspheres with a Three-Pronged Approach Alleviate Age-Related Osteoarthritis; Authors - Yanpeng Lin
mouse	WB	Adv Healthc Mater; Legumain-Guided Ferulate-Peptide Self-Assembly Enhances Macrophage-Endotheliocyte Partnership to Promote Therapeutic Angiogenesis After Myocardial Infarction; Authors - Delong Xu
mouse	IF	Adv Healthc Mater; Peptide-Enhanced Bioactive Hydrogel Combined with Photodynamic-Phage Synergistic Antibacterial Therapy System Accelerates Infected Wound Healing; Authors - Liang Quan
mouse	WB,IHC,IF	Food Sci Nutr; Sea conch (Rapana venosa) peptide hydrolysate regulates NF-κB pathway and restores intestinal immune homeostasis in DSS-induced colitis mice; Authors - Hidayat Ullah
human	IF	ACS Appl Mater Interfaces; Monitoring the Cascade of Monocyte-Derived Macrophages to Influenza Virus Infection in Human Alveolus Chips; Authors - Chenguang Wang