B7-H6 Polyclonal antibody

• 

  WB analysis of HEK-293 using 27428-1-AP

  WB result of B7-H6 antibody (27428-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-B7-H6 transfected HEK-293 cells.

• 

  WB analysis using 27428-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27428-1-AP (B7H6 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

B7-H6 Polyclonal Antibody for WB, ELISA

Cat No. 27428-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

B7H6, NCR3LG1, B7 H6, B7 homolog 6, Natural cytotoxicity triggering receptor 3 ligand 1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27428-1-AP targets B7-H6 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26532

  Product name: Recombinant human DKFZp686O24166 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-259 aa of BC136800

  Sequence: DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTD

• Full Name: hypothetical protein DKFZp686O24166
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 75-80 kDa
• GenBank Accession Number: BC136800
• Gene Symbol: B7H6
• Gene ID (NCBI): 374383
• RRID: AB_3085956
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q68D85
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

B7-H6, also known as NCR3LG1, is a member of the B7 family of immunoreceptors. It is a 454-aa-long type I transmembrane protein consisting of an extracellular region, a transmembrane segment, and a cytoplasmic domain which contains an immunoreceptor tyrosine-based inhibitory motif (ITIM), an SH2-binding domain, and an SH3-binding motif. B7-H6 triggers NKp30-mediated activation of human NK cells (PMID: 19528259). It has been reported that B7H6 is expressed in various types of tumor cells and plays a prominent role in natural killer cell immunosurveillance (PMID: 35697295). The apparent molecular weight of B7-H6 is larger than the calculated molecular weight of 51 kDa due to glycosylation (PMID: 19528259).