Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

BAG6 Monoclonal antibody

BAG6 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66661-1-Ig
Clone No.1B8D3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

BAT3, 1B8D3, BAG 6, BAG family molecular chaperone regulator 6, BAG-6

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, HEK-293 cells, HeLa cells, HSC-T6 cells, NIH/3T3 cells, RAW 274.7 cells, PC-12 cells, Jurkat cells, HepG2 cells
Positive IHC detected inhuman breast cancer tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66661-1-Ig targets BAG6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24525

Product name: Recombinant human BAG6 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-184 aa of BC003133

Sequence: MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGPGASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLLSRME

Predict reactive species
Full Name HLA-B associated transcript 3
Calculated Molecular Weight 119 kDa
Observed Molecular Weight 150-160 kDa
GenBank Accession NumberBC003133
Gene Symbol BAT3/BAG-6
Gene ID (NCBI) 7917
RRIDAB_2858188
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP46379
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BAT3 also known as Scythe or BAG6, is a nuclear protein implicated in the control of apoptosis and natural killer (NK) cell-dendritic cell (DC) interaction. BAT3 was first discovered as a member of a group of genes located within the class III region of the human major histocompatibility complex on chromosome 6, and has been extensively studied for its role in regulating apoptosis under various stress conditions such as DNA damage and endoplasmic reticulum-related stress. BAT3 has been shown to be required for p53 acetylation, which is critical for the enhancement of p53 transcriptional activity in response to DNA damage. In addition, BAT3 is involved in the regulation of development and reproduction of mammals by acting as a co-chaperone of the heat shock protein HSP70.

Protocols

Product Specific Protocols
IHC protocol for BAG6 antibody 66661-1-IgDownload protocol
WB protocol for BAG6 antibody 66661-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle

Mol Cell

Intrinsic bias of the genetic code shapes the folding and stability landscapes of microproteins.

Authors - Yabo Guo
humanWB

Mol Cell

RNF126-Mediated Reubiquitination Is Required for Proteasomal Degradation of p97-Extracted Membrane Proteins.

Authors - Xianyan Hu
Loading...
||
New chat

Able

正在加载,请稍候...