IRSp53 Polyclonal antibody

• 

  WB analysis of mouse brain using 11087-2-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 11087-2-AP (IRSp53 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 11087-2-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 11087-2-AP (IRSp53 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 11087-2-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11087-2-AP (IRSp53 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 11087-2-AP

  IP result of anti-IRSp53 (IP:11087-2-AP, 4ug; Detection:11087-2-AP 1:500) with mouse brain tissue lysate 2640ug.

• 

  IHC staining of mouse brain using 11087-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11087-2-AP (IRSp53 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 11087-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11087-2-AP (IRSp53 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 11087-2-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11087-2-AP (IRSp53 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 11087-2-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11087-2-AP (IRSp53 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 11087-2-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 11087-2-AP (IRSp53 antibody at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human brain using 11087-2-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 11087-2-AP (IRSp53 antibody at dilution of 1:200 (under 40x lens).

IRSp53 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 11087-2-AP

Publications(10)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

BAI associated protein 2, BAI1 associated protein 2, BAIAP2, BAP2, Fas ligand associated factor 3, FLAF3, Insulin receptor substrate p53, IRS 58, IRSp53, IRSp53/58, Protein BAP2

---

Tested Applications

• Positive WB detected in: mouse brain tissue, human brain tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse brain tissue, human brain tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 8 publications below
• IHC: See 1 publications below
• IF: See 1 publications below
• IP: See 1 publications below

Product Information

11087-2-AP targets IRSp53 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, hamster
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1552

  Product name: Recombinant human BAIAP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC014020

  Sequence: MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMN

• Full Name: BAI1-associated protein 2
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC014020
• Gene Symbol: IRSp53
• Gene ID (NCBI): 10458
• RRID: AB_2063075
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UQB8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IRSp53 (also known as BAIAP2) is a multi-domain adaptor protein that originally identified as a 58/53-kDa substrate of insulin-receptor kinase in the hamster (PMID: 10332026). As a BAI1-binding protein, IRSp53 plays an important role in linking between membrane and cytoskeleton in the process of neuronal growth (PMID: 10343108). IRSp53 is necessary for Cdc42-mediated reorganization of the actin cytoskeleton and for Rac1-mediated membrane ruffling. Alternatively spliced isoforms of IRSp53 exist. IRSp53 has been implicated in several psychiatric disorders, including autism spectrum disorders (ASDs), schizophrenia, and attention deficit/hyperactivity disorder (ADHD) (PMID: 26275848).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Hum Mol Genet; Interactome network analysis identifies multiple caspase-6 interactors involved in the pathogenesis of HD.; Authors - Sean-Patrick Riechers
human	WB	Biol Cell; Extracellular vesicles containing the I-BAR protein IRSp53 are released from the cell plasma membrane in an Arp2/3 dependent manner.; Authors - Alice Trausch
hamster	WB,IP	Proteomics; Proteomics Analysis Identifies IRSp53 and Fascin as Critical for PRV Egress and Direct Cell-Cell Transmission.; Authors - Fei-Long Yu
mouse	WB	JCI Insight; Disruption of Robo2-Baiap2 integrated signaling drives cystic disease.; Authors - Qinggang Li
mouse	IF	Lab Invest; FAK Signaling Induces the Onset of Proteinuria via FAK Signaling in a Mouse Model of Lung Cancer; Authors - Sheng-Wen Niu
human	IHC	Elife; Proteomic characteristics reveal the signatures and the risks of T1 colorectal cancer metastasis to lymph nodes; Authors - Aojia Zhuang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

anwesh (Verified Customer) (10-28-2019)

Bands detected at the correct molecular weight. Great antibody.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: 293T, U2OS, A549

IRSp53 Antibody Western Blot, validation (1:1000 dilution) in 293T, U2OS, A549 (Cat no:11087-2-AP)