BAIAP2L1 Polyclonal antibody

BAIAP2L1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25692-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

BAI1-associated protein 2-like protein 1, BAR/IMD domain-containing adapter protein 2-like 1, Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1, IRTKS

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis of HeLa using 25692-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 25692-1-AP (BAIAP2L1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of SGC-7901 using 25692-1-AP
SGC-7901 cells were subjected to SDS PAGE followed by western blot with 25692-1-AP (BAIAP2L1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of K-562 using 25692-1-AP
K-562 cells were subjected to SDS PAGE followed by western blot with 25692-1-AP (BAIAP2L1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary tumor using 25692-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 25692-1-AP (BAIAP2L1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary tumor using 25692-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 25692-1-AP (BAIAP2L1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse stomach using 25692-1-AP
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 25692-1-AP (BAIAP2L1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 25692-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 25692-1-AP (BAIAP2L1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 25692-1-AP
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 25692-1-AP (BAIAP2L1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat kidney using 25692-1-AP
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 25692-1-AP (BAIAP2L1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 25692-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 25692-1-AP (BAIAP2L1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 25692-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 25692-1-AP (BAIAP2L1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (1)
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HeLa cells, SGC-7901 cells, K-562 cells
Positive IHC detected in	human ovary tumor tissue, human stomach cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25692-1-AP targets BAIAP2L1 in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag22499 Product name: Recombinant human BAIAP2L1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 198-388 aa of BC013888 Sequence: DKHCGFANHIHYYHLQSAELLNSKLPRWQETCVDAIKVPEKIMNMIEEIKTPASTPVSGTPQASPMIERSNVVRKDYDTLSKCSPKMPPAPSGRAYTSPLIDMFNNPATAAPNSQRVNNSTGTSEDPSLQRSVSVATGLNMMKKQKVKTIFPHTAGSNKTLLSFAQGDVITLLIPEEKDGWLYGEHDVSKA Predict reactive species
Full Name	BAI1-associated protein 2-like 1
Calculated Molecular Weight	511 aa, 57 kDa
Observed Molecular Weight	57 kDa
GenBank Accession Number	BC013888
Gene Symbol	BAIAP2L1
Gene ID (NCBI)	55971
RRID	AB_2880197
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9UHR4
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BAIAP2L1, also known as IRTKS, is a 511-amino acid protein containing an IRSp53/MIM homology domain (IMD) that bundles actin filaments and interacts with the small GTPase Rac (PMID: 17430976; 14752106). In addition to the IMD domain, BAIAP2L1 also contains an SH3 domain and WW domain interaction motif. BAIAP2L1 is widely distributed and is an INS receptor substrate. It has a role in actin remodeling and membrane protrusion.